PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P27500_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TCP
Protein Properties Length: 289aa    MW: 30393.2 Da    PI: 8.773
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P27500_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP126.13.6e-3972145275
                    TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasecea 75 
                            a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+pai+++tgt++++as+  a
  GSMUA_Achr1P27500_001  72 APKRSSNKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETIQWLLQQAEPAIIAATGTGTIPASALAA 145
                            789*****************************************************************977633 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.3E-3277146IPR005333Transcription factor, TCP
PROSITE profilePS5136928.41878132IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MDLKGSAKLP QEVPKFHRAL GLPQSDKREP TTASSAAESC DLSPSTTSGG RELKAVATAA  60
AAEKDEQRRQ LAPKRSSNKD RHTKVDGRGR RIRMPALCAA RVFQLTRELG HKSDGETIQW  120
LLQQAEPAII AATGTGTIPA SALAAAGSVP NPGPTVLAGV HQKPDEAGQG AIAALRPNWA  180
MVGAAGLPRS HLGFFIHRMA LHGMELPSAN LGAMSFASMF GGHGQQLPGL ELGLSQDAHI  240
GVLNSQALSQ FYQQMTPGRL GAGADGSGRL QQPQQQSHLA EDDSQESQD
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00636PBMTransfer from Glyma.19G095300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009420155.10.0PREDICTED: transcription factor TCP20-like
SwissprotQ9LSD51e-63TCP20_ARATH; Transcription factor TCP20
TrEMBLM0S3K70.0M0S3K7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P27500_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.13e-63TCP family protein